PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_02277_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family NF-YA
Protein Properties Length: 1079aa    MW: 120300 Da    PI: 8.8185
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_02277_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA95.65.7e-30156212158
                   CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                                 d p+YVNaKQy++Il+RRq+Rak+  e+kl +k+rkpy+h SRh hA+rRpRg+gGrF
  Cotton_A_02277_BGI-A2_v1.0 156 DGPIYVNAKQYNGILRRRQSRAKAVLENKL-TKARKPYMHYSRHLHAMRRPRGCGGRF 212
                                 57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.8E-34154215IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.446155215IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.3E-26158212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-20158180IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-20189212IPR001289Nuclear transcription factor Y subunit A
PfamPF082632.1E-7326369IPR013210Leucine-rich repeat-containing N-terminal, plant-type
Gene3DG3DSA:3.80.10.101.7E-33326509IPR032675Leucine-rich repeat domain, L domain-like
SuperFamilySSF520583.57E-49349672IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM0036958396420IPR003591Leucine-rich repeat, typical subtype
SMARTSM00369400442465IPR003591Leucine-rich repeat, typical subtype
Gene3DG3DSA:3.80.10.104.1E-25513656IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM00369180609632IPR003591Leucine-rich repeat, typical subtype
PfamPF138551.2E-7634695IPR001611Leucine-rich repeat
SuperFamilySSF520589.07E-56647781IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.101.5E-37657791IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM0036995658682IPR003591Leucine-rich repeat, typical subtype
SMARTSM0036915706729IPR003591Leucine-rich repeat, typical subtype
PfamPF138551.4E-8707767IPR001611Leucine-rich repeat
SMARTSM0036938730754IPR003591Leucine-rich repeat, typical subtype
SuperFamilySSF520589.07E-56857988IPR032675Leucine-rich repeat domain, L domain-like
Gene3DG3DSA:3.80.10.101.7E-30860987IPR032675Leucine-rich repeat domain, L domain-like
SMARTSM00369240925948IPR003591Leucine-rich repeat, typical subtype
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1079 aa     Download sequence    Send to blast
MAMQTLYAKE HDGIVHNPMG QLAPVPSQPW WSALGSQSSI YGESCGQLKN LLMEHPSNGD  60
QLTCTKQAGR VNEQGLNKGN PAHFTIFPGD GQKSPAVKSL QSAPSEQHSR FELGFRQPPM  120
VCAKYPYMDQ CYGVFSTYGP PVSGRVMLPL NIASEDGPIY VNAKQYNGIL RRRQSRAKAV  180
LENKLTKARK PYMHYSRHLH AMRRPRGCGG RFLNTKTGKD EKETKKDEGK VLHTTGSQNS  240
EVLQSDSGTL NSSKEAIGGG LTLSGSEVTS MYSREELEHN FPISHLGLSF HSFPVMMENG  300
RGSVMPNRWV APADHSFITV SGNSLNTDKE ILLNLKSFLE NQNRVNRGRY SGWNRWTSNP  360
CEWHGIMCSP DMERVTGINL SDSKISGEMF NNFSALTQLH HLDFSRNTLK GLIPDDLNRC  420
HNLVYLNLSH NILGGELKLT GLTRLEKLDL STNRFHGEVK FSFPAICNRL VVANLSMNNF  480
IGRIDTFFDG CLNLMYLDLS SNKFAGNIWT GFSRLVVFSV SENRVSGLIS ASSFSDNCHL  540
KGLDLSVNMF HGEVPREISY CKKLVMLNLW GNKFSGPIPS ELGSISTLEG LLLGNNEFSR  600
VIPESLLYLN NLAVLDLSYN NFGGRLQEIF GRFRQLKSLV LQGNSYIDGL SFSGIHKLTN  660
ISRLDLSYNN FSGHLPAEFS EMVGLKFLIL AYNQFTGPIP PQYGDLSQLQ ALDLSFNRLI  720
GSIPPSFGNL RSLLWLMLAN NSLTGEIPGE LGNCSSLLWL NLANNQLSKR FPPELANIGR  780
NPTLTFESNR RSNAMIAGPS DCLVTKRLLT MDYSPFGFIY TILTRKICKN VWDQLLQGYG  840
FFQVCVKGSP VRKYRVSGYL QLSGNKLTGE VPSDIGKMQH FSVLHLSYNQ FNGELPVEIG  900
NLPLVVLNIS WNKFSGQIPR EIGNLNCLQN LDLSHNNFSG IFPTNLNCLN ELSKFNISFN  960
PQIAGQIPNI GQLATFEEES YLGNPFLHSR LFKLQDPSVP PLNSGKEALP GEEESEDGFW  1020
WKALLMEYGC GMAFGMVMLF ICVVKVQPKW VVNKVEGLHQ LKAVRPWKKN GSRGGGRII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3rgx_A1e-6435699833751Protein BRASSINOSTEROID INSENSITIVE 1
3rgz_A1e-6435699833751Protein BRASSINOSTEROID INSENSITIVE 1
3riz_A9e-6535699830748Protein BRASSINOSTEROID INSENSITIVE 1
3rj0_A9e-6535699830748Protein BRASSINOSTEROID INSENSITIVE 1
4lsa_A1e-6435699832750Protein BRASSINOSTEROID INSENSITIVE 1
4lsx_A1e-6435699832750Protein BRASSINOSTEROID INSENSITIVE 1
4lsx_B1e-6435699832750Protein BRASSINOSTEROID INSENSITIVE 1
4m7e_A1e-6435699832750Protein BRASSINOSTEROID INSENSITIVE 1
4m7e_B1e-6435699832750Protein BRASSINOSTEROID INSENSITIVE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012468113.10.0PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g74360
SwissprotC0LGJ10.0Y1743_ARATH; Probable LRR receptor-like serine/threonine-protein kinase At1g74360
TrEMBLA0A0D2RBI30.0A0A0D2RBI3_G
STRINGPOPTR_0015s07270.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.25e-51nuclear factor Y, subunit A10